Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFVALSFDWVFFFGVNMDTIEAKKNLNALCNEIEKLQNLSRSLMTAKEMLDIDAKIKRHKEQVKNIRSNLHA 1VCS Chain:A ((43-91)) ---------------------VEKQLEEARELLEQMDLEVRE-IPPQSRGMYSNRMRSYKQEMGKLETDFK-

General information: TITO was launched using: RESULT: Template: 1VCS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 71 -11887 -167.42 -242.58 target 2D structure prediction score : 0.76 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -167.42 2D Compatibility (Sec. Struct. Predict.) : 0.76 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.801

(partial model without unconserved sides chains): PDB file : Tito_1VCS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1VCS-query.scw PDB file : Tito_Scwrl_1VCS.pdb: