Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence------------------------------------------------------------------MSKIYIIKEMLFDQLLFGISSKQNGKVYGATLPFCFSNTQVSL-------------------
5U35 Chain:A ((1-124))GSHMTEEEVRKIMEKLKKAFKQGNPEQIVSLLSPDVKVDVGNQSFSGSEEAEKAARKLMKFVDRVEVRDVRVFENAVMIAVEFEV----NGQRYKMIFTFYVENGKVSMVSIYISPTMKKLMKQILNY


General information:
TITO was launched using:
RESULT:

Template: 5U35.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 34 -6524 -191.87 -167.27
target 2D structure prediction score : 0.54
Monomeric hydrophicity matching model chain A : 0.62

3D Compatibility (PKB) : -191.87
2D Compatibility (Sec. Struct. Predict.) : 0.54
1D Compatibility (Hydrophobicity) : 0.62
QMean score : 0.393

(partial model without unconserved sides chains):
PDB file : Tito_5U35.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5U35-query.scw
PDB file : Tito_Scwrl_5U35.pdb: