Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLEYSGFFIKAVTLKKDIIIVLFFLLLLIGRFILIHYSPLPIIKEKTG-SGCSNYMLRKKNP 1T01 Chain:B ((1-24)) --------------------------------------GRPLLQAAKGLAGAVSELLRSAQP

General information: TITO was launched using: RESULT: Template: 1T01.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 2 234 117.00 10.17 target 2D structure prediction score : 0.35 Monomeric hydrophicity matching model chain B : 0.44 3D Compatibility (PKB) : 117.00 2D Compatibility (Sec. Struct. Predict.) : 0.35 1D Compatibility (Hydrophobicity) : 0.44 QMean score : 0.166

(partial model without unconserved sides chains): PDB file : Tito_1T01.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1T01-query.scw PDB file : Tito_Scwrl_1T01.pdb: