Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MANEHYFYVLFCKDQTFYGGYTTDLSRRLEEHNNGTGAKYTRLQKRRPVKMIHAEVFSSRSEATKAEAAFKKLTRKQKERYLQTHSTVLLPESI 5H07 Chain:C ((21-86)) --------------------DCAEVKQELAASRTARDAALERVQMLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVS--------

General information: TITO was launched using: RESULT: Template: 5H07.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 3 -242 -80.50 -3.66 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain C : 0.56 3D Compatibility (PKB) : -80.50 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.497

(partial model without unconserved sides chains): PDB file : Tito_5H07.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5H07-query.scw PDB file : Tito_Scwrl_5H07.pdb: