Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence--MAKKSKIAKAKKQQETIERYAALRQELKAQKDYEGLRKLPLMLVQND---
2O98 Chain:P ((1-52))TNFNELNQLAEEAKRRAEIARQRELHTLKGHVESVVKLKGLDIETIQQSYDI


General information:
TITO was launched using:
RESULT:

Template: 2O98.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain P - contact count / total energy / energy per contact / energy per residue : 44 3039 69.06 64.65
target 2D structure prediction score : 0.74
Monomeric hydrophicity matching model chain P : 0.64

3D Compatibility (PKB) : 69.06
2D Compatibility (Sec. Struct. Predict.) : 0.74
1D Compatibility (Hydrophobicity) : 0.64
QMean score : 0.455

(partial model without unconserved sides chains):
PDB file : Tito_2O98.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2O98-query.scw
PDB file : Tito_Scwrl_2O98.pdb: