Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKKMKKYKIRKSGNSDVTTIPPEVKEFMGVQTGDAISYVFQS-DGSVRMIKAQEEPDIDSLVDSIMNQYEDALKDLVDL 2L66 Chain:B ((2-50)) ----AVEEIVKVSRNYQVTIPAKVRQKFQIKEGDLVKVTFDESEGVVKIQLLK--------------------------

General information: TITO was launched using: RESULT: Template: 2L66.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 75 -6615 -88.20 -137.81 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain B : 0.64 3D Compatibility (PKB) : -88.20 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.534

(partial model without unconserved sides chains): PDB file : Tito_2L66.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2L66-query.scw PDB file : Tito_Scwrl_2L66.pdb: