Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MENPTFEESLQELEKIVMQL-EQGDVPLESALDSFKRGMELSKHCQDTLAKAEETLTKMMTESNEEVDFDGNEES 2V8S Chain:V ((17-70)) ----IFRGLLEDLQGVPERLLGTA--GTEEKKKLVRDFDEKQQEANETLAEMEEELRYAP---------------

General information: TITO was launched using: RESULT: Template: 2V8S.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain V - contact count / total energy / energy per contact / energy per residue : 69 -1910 -27.67 -36.03 target 2D structure prediction score : 0.79 Monomeric hydrophicity matching model chain V : 0.71 3D Compatibility (PKB) : -27.67 2D Compatibility (Sec. Struct. Predict.) : 0.79 1D Compatibility (Hydrophobicity) : 0.71 QMean score : 0.619

(partial model without unconserved sides chains): PDB file : Tito_2V8S.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2V8S-query.scw PDB file : Tito_Scwrl_2V8S.pdb: