Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYWGDISREEVNEKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHY 3HHM Chain:B ((12-92)) WYWGDISREEVNEKLRDTADGTFLVRDASTK--GDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHY

General information: TITO was launched using: RESULT: Template: 3HHM.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 260 -31830 -122.42 -430.14 target 2D structure prediction score : 0.78 Monomeric hydrophicity matching model chain B : 0.99 3D Compatibility (PKB) : -122.42 2D Compatibility (Sec. Struct. Predict.) : 0.78 1D Compatibility (Hydrophobicity) : 0.99 QMean score : 0.764

(partial model without unconserved sides chains): PDB file : Tito_3HHM.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3HHM-query.scw PDB file : Tito_Scwrl_3HHM.pdb: