Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFHGILTLKKANELLLSTGMP-GSFLIRVSERIKG-YALSY-----LSEDGCKHFLIDASADAYSFLGVDQLQHATLADLVEYH 4U1P Chain:A ((23-105)) WYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKI-RKLDNGGYYITTRAQFETLQQLVQHY

General information: TITO was launched using: RESULT: Template: 4U1P.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 258 -10242 -39.70 -134.76 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain A : 0.76 3D Compatibility (PKB) : -39.70 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.76 QMean score : 0.530

(partial model without unconserved sides chains): PDB file : Tito_4U1P.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4U1P-query.scw PDB file : Tito_Scwrl_4U1P.pdb: