Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLFKKFAVAAAVAATLAFVGCSKKEEAPAAASEAVAAASEATAAAAAASEAAAAAASEAAVAVDAAASETAAASEAAAAH 5U0P Chain:I ((47-121)) -----TLLRQGIRQLKEKVSKMEPEEMTVKEKKSIIEILKARIALKKAFLKMALSESNDTVVKKEDVRESPVDTFMENAT

General information: TITO was launched using: RESULT: Template: 5U0P.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain I - contact count / total energy / energy per contact / energy per residue : 84 3964 47.18 52.85 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain I : 0.64 3D Compatibility (PKB) : 47.18 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.665

(partial model without unconserved sides chains): PDB file : Tito_5U0P.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5U0P-query.scw PDB file : Tito_Scwrl_5U0P.pdb: