Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence GKNGLKDCQVSLTATSEARRSFWDTQYADYNDDVEISAGRHKFVIHVEQDCGGSKVSGTIPPHHLVILSPMSGGGRRTIINSAGEVRLAAT 2R9Q Chain:C ((240-297)) --------------------DFWEPLFARGRAELILDPDEFYIL--------VSREAVHVPPLYAAEMTPFDPLVGEFRVHYAG-------

General information: TITO was launched using: RESULT: Template: 2R9Q.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain C - contact count / total energy / energy per contact / energy per residue : 63 -10504 -166.73 -187.57 target 2D structure prediction score : 0.63 Monomeric hydrophicity matching model chain C : 0.66 3D Compatibility (PKB) : -166.73 2D Compatibility (Sec. Struct. Predict.) : 0.63 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.170

(partial model without unconserved sides chains): PDB file : Tito_2R9Q.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2R9Q-query.scw PDB file : Tito_Scwrl_2R9Q.pdb: