Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKCKKYEEFGLDSLLQETRGGRNHAYMTVEQEKVFLARHLKATEAGEFVTIDALFQAYKKELGRSYTRDAFYQLLKRHGWRNITPRPEHPRKADAQTIVASKNKVSIQEDK 2LVS Chain:A ((37-104)) -KALEKLEAMGRIKRR-KGRYRQH-RRLTEEELATI-RELYLK-----GATVYEIARQL----G--RPESTIYYALKKLGLKL-----------------------------

General information: TITO was launched using: RESULT: Template: 2LVS.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 136 -18168 -133.58 -267.17 target 2D structure prediction score : 0.57 Monomeric hydrophicity matching model chain A : 0.66 3D Compatibility (PKB) : -133.58 2D Compatibility (Sec. Struct. Predict.) : 0.57 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.610

(partial model without unconserved sides chains): PDB file : Tito_2LVS.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LVS-query.scw PDB file : Tito_Scwrl_2LVS.pdb: