Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MATMQCDVVSVKESLYSGAVTMLIAKGAGGELGILPGHAPLVTLLQLGPIRVLLENGTEEIVYVSGGVLEVQPHVVTVLADTAIRADNLDEAAILEARKNAEQLLANQKSDLDSAAALAALAETAAQLETIRKIKNRAQ 5IK2 Chain:H ((3-82)) --TVQVDIVTPERKVFQGEADIVIARGVEGELGVMAGHIPLVTPLKTAPVRI-KQGDKETLIAVSGGFLEVRPDKVNILADTA--------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 5IK2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 383 -78583 -205.18 -982.29 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain H : 0.75 3D Compatibility (PKB) : -205.18 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.75 QMean score : 0.646

(partial model without unconserved sides chains): PDB file : Tito_5IK2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5IK2-query.scw PDB file : Tito_Scwrl_5IK2.pdb: