Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVFRSGLLLACAAVFLQIAVFLQPLLPKQYQIAPVCETITRALLKPKAQTEAMSHAMHHTHHQHHIEQ----AQVPDHHDHHDA---NHQCQYCTVYANLVLPPEFGVKEVLVRIQVRLVAYQQAFRHVYFALQRLFLLPQGRAPPLFA 1HCI Chain:A ((422-484)) ----------------------QILLQKDYESASLTEV--RALLRKHEAFESDLAA-----HQDRVEQIAAIAQELNELDYHDAVNVNDRCQ---------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1HCI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 39 -2136 -54.76 -38.13 target 2D structure prediction score : 0.61 Monomeric hydrophicity matching model chain A : 0.54 3D Compatibility (PKB) : -54.76 2D Compatibility (Sec. Struct. Predict.) : 0.61 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.397

(partial model without unconserved sides chains): PDB file : Tito_1HCI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1HCI-query.scw PDB file : Tito_Scwrl_1HCI.pdb: