Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MQVATKLGSTPAMDRYL---CVRYISGRSIKVMYT--GWEIEELKIGGHRHKWNLDLEVP-- 1KOY Chain:A ((239-300)) SHILTALREKQAPELSLSSQDLELVTKEDPKALAVALNWDIKKTETVQEACERELALRLQQT

General information: TITO was launched using: RESULT: Template: 1KOY.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 168 10077 59.98 183.21 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain A : 0.72 3D Compatibility (PKB) : 59.98 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.72 QMean score : 0.125

(partial model without unconserved sides chains): PDB file : Tito_1KOY.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1KOY-query.scw PDB file : Tito_Scwrl_1KOY.pdb: