Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYKPYMISYDLNNPGQKYDKVFEIIKEFG----AYIKLQKSFWLVKTNLNPNQMCEKLNTVLDNNDSLFICELQKNYQGRATEENWKFINEHIFS 4G0V Chain:A ((598-688)) -----MVLFDHMGCLKKYETVQDILKEFFDLRLSYYGLRKE-WLVG-------MLGAESTKL-NNQARFILE---KIQGKITIEN----------

General information: TITO was launched using: RESULT: Template: 4G0V.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 56 361 6.45 5.64 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : 6.45 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.205

(partial model without unconserved sides chains): PDB file : Tito_4G0V.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4G0V-query.scw PDB file : Tito_Scwrl_4G0V.pdb: