Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYHGHMSGGQAETLLQAKGEPWTFLVRESLSQPGDFVLSVLS--DQPKAGPGSPLRVTHIKVMCEGGRYTVGGLETFD 4OHI Chain:A ((112-212)) WFHGHLSGKEAEKLLTEKGKHGSFLVRESQSHPGDFVLSVRTGDDKGESNDGKS-KVTHVMIRCQELKYDVGGGERFD

General information: TITO was launched using: RESULT: Template: 4OHI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 259 -9082 -35.07 -121.09 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain A : 0.84 3D Compatibility (PKB) : -35.07 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.595

(partial model without unconserved sides chains): PDB file : Tito_4OHI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4OHI-query.scw PDB file : Tito_Scwrl_4OHI.pdb: