Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence REKLRDTPDGTFLVRDASSKIQGEYTLTLRKGGNNKLIKVFHRDGHYGFSEPLTFCSVVDLINHY 4L1B Chain:B ((54-117)) -EKLRDTADGTFLVRDASTKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHY

General information: TITO was launched using: RESULT: Template: 4L1B.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 206 -24402 -118.46 -381.28 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain B : 1.00 3D Compatibility (PKB) : -118.46 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 1.00 QMean score : 0.822

(partial model without unconserved sides chains): PDB file : Tito_4L1B.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4L1B-query.scw PDB file : Tito_Scwrl_4L1B.pdb: