Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence---------MEFFGNK-----------PFTQQPQRAITQANQLLDYKSWSEEDRK-MFSQLHMREEQVLLAQDYA--------LETARAEDLEQGLER-GKVEGRAERKLFTFLDIVRQGLLTSEVASQ----QLGMSVSEFEALL-----
3ZFP Chain:A ((1-148))MEPLYDKNGAVLFGEPSDTHPQSTLKLPHPRGEKEVIVGIRDLPRKGDCRTGNRLGPVSGLFVKPGP-VFYQDYSGPVYHRAPLEQFKQAPMCEVTKRIGRVTG-SDGNLYH-MYVCTDGCILVKTAKHHHHHVLKWVYNVLDSPIWVTSC


General information:
TITO was launched using:
RESULT:

Template: 3ZFP.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 403 7928 19.67 72.73
target 2D structure prediction score : 0.27
Monomeric hydrophicity matching model chain A : 0.68

3D Compatibility (PKB) : 19.67
2D Compatibility (Sec. Struct. Predict.) : 0.27
1D Compatibility (Hydrophobicity) : 0.68
QMean score : 0.179

(partial model without unconserved sides chains):
PDB file : Tito_3ZFP.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3ZFP-query.scw
PDB file : Tito_Scwrl_3ZFP.pdb: