Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequence-MNTKKMSQFEIMDT-------EMLACVEGGGCNWGDFAKAGVGGGAVRGLQLGIKTRTWQGAATGAAGGAILGGVAYAATCWW
2EFV Chain:A ((6-87))FMKEKKRATFYLYKNIDGRKLRYLLHKLENVENVDIDTLRRAIEAE--KKYKRSITLTEEEEVIIQRLGKSANLLLNCELVKLD


General information:
TITO was launched using:
RESULT:

Template: 2EFV.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 195 6381 32.72 86.23
target 2D structure prediction score : 0.59
Monomeric hydrophicity matching model chain A : 0.61

3D Compatibility (PKB) : 32.72
2D Compatibility (Sec. Struct. Predict.) : 0.59
1D Compatibility (Hydrophobicity) : 0.61
QMean score : 0.226

(partial model without unconserved sides chains):
PDB file : Tito_2EFV.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2EFV-query.scw
PDB file : Tito_Scwrl_2EFV.pdb: