Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMAKD-DVIEVEGKVVDTMPNAMFTVELENGHQILATVSGKIRKNYIRILAGDRVTVEMSPYDLTRGRITYRFK
5LMV Chain:W ((1-70))-AKEKDTIRTEGVVTEALPNATFRVKLDSGPEILAYISGKMRMHYIRILPGDRVVVEITPYDPTRGRIVYR--


General information:
TITO was launched using:
RESULT:

Template: 5LMV.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain W - contact count / total energy / energy per contact / energy per residue : 282 2667 9.46 38.64
target 2D structure prediction score : 0.58
Monomeric hydrophicity matching model chain W : 0.87

3D Compatibility (PKB) : 9.46
2D Compatibility (Sec. Struct. Predict.) : 0.58
1D Compatibility (Hydrophobicity) : 0.87
QMean score : 0.650

(partial model without unconserved sides chains):
PDB file : Tito_5LMV.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-5LMV-query.scw
PDB file : Tito_Scwrl_5LMV.pdb: