Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------------------------------------------------------------------------------------------------------------------------MRKVWHKLLPLLPYSPEYNPIE-KTWAHIKKHLKKVLPSCNTFYEALLSCSCFN----------------------------- 2F7T Chain:A ((1-227)) WVPHELNERQMERRKNTCEILLSRYKRKSFLHRIVTGDEKWIFFVNPKKTMLCVWWDQSGVIYYELLKPGETVNAARYQQQLINLNRALQRKRPEYQKRQHRVIFLHDNAPSHTARAVRDTLETLNWEVLPHAAYSPDLAPSDYHLFASMGHALAEQRFDSYESVKKWLDEWFAAKDDEFYWRGIHKLPERWEKCVASDGKYFE

General information: TITO was launched using: RESULT: Template: 2F7T.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 40 -65 -1.63 -1.23 target 2D structure prediction score : 0.68 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -1.63 2D Compatibility (Sec. Struct. Predict.) : 0.68 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.506

(partial model without unconserved sides chains): PDB file : Tito_2F7T.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2F7T-query.scw PDB file : Tito_Scwrl_2F7T.pdb: