Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDKKQNLTSFQELTTTELNQITGGGWWEELLHETILSKFKITKALELPIQL 5A0Y Chain:F ((19-41)) CNPEYELEKLREISDEDVVKILG----------------------------

General information: TITO was launched using: RESULT: Template: 5A0Y.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain F - contact count / total energy / energy per contact / energy per residue : 7 -1212 -173.14 -52.70 target 2D structure prediction score : 0.70 Monomeric hydrophicity matching model chain F : 0.59 3D Compatibility (PKB) : -173.14 2D Compatibility (Sec. Struct. Predict.) : 0.70 1D Compatibility (Hydrophobicity) : 0.59 QMean score : 0.543

(partial model without unconserved sides chains): PDB file : Tito_5A0Y.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5A0Y-query.scw PDB file : Tito_Scwrl_5A0Y.pdb: