Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MANKQDLIAKVAEATELTKKDSAAAVEAVFAAVADYLAAGEKVQLIGFGNFEVRERAERKGRNPQTGKEMTIAASKVPAFKAGKALKDAVK 4YFH Chain:A ((2-90)) --NKTQLIDVIAEKAELSKTQAKAALESTLAAITESLKKGDALQLVGFGTFKVNHRAE----------------ANVPAFVSGKALKDAVK

General information: TITO was launched using: RESULT: Template: 4YFH.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 168 -15454 -91.99 -211.70 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.84 3D Compatibility (PKB) : -91.99 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.84 QMean score : 0.555

(partial model without unconserved sides chains): PDB file : Tito_4YFH.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4YFH-query.scw PDB file : Tito_Scwrl_4YFH.pdb: