Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAQQRRGGFKRRKKVDYIAANKIEYVDYKDTELLSRFVSERGKILPRRVTGTSAKNQRKVTTAIKRARVMALMPFVNED 2UUC Chain:R ((33-84)) --------------------------DYRNVEVLKRFLSETGKILPRRRTGLSAKEQRILAKTIKRARILGLLPFTEK-

General information: TITO was launched using: RESULT: Template: 2UUC.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain R - contact count / total energy / energy per contact / energy per residue : 144 -13477 -93.59 -259.17 target 2D structure prediction score : 0.71 Monomeric hydrophicity matching model chain R : 0.80 3D Compatibility (PKB) : -93.59 2D Compatibility (Sec. Struct. Predict.) : 0.71 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.468

(partial model without unconserved sides chains): PDB file : Tito_2UUC.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2UUC-query.scw PDB file : Tito_Scwrl_2UUC.pdb: