Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSQKLYNMKFAAVYLALIAKVERKGGKAESVHQVTSWLTGYEVSDVLACLDRDVTYGDFFRQAPYYVPERIAITGKICGVRIEEIDDPLMQEIRRLDKLVDWLAKGKTSQQVLEKYEKHK 1XK7 Chain:B ((377-400)) -----------------------------DTAAILKNI-GYSENDIQELVSKGL------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1XK7.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 33 -3793 -114.94 -158.04 target 2D structure prediction score : 0.88 Monomeric hydrophicity matching model chain B : 0.54 3D Compatibility (PKB) : -114.94 2D Compatibility (Sec. Struct. Predict.) : 0.88 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.286

(partial model without unconserved sides chains): PDB file : Tito_1XK7.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1XK7-query.scw PDB file : Tito_Scwrl_1XK7.pdb: