Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MWIAISALNLAFAVMLGAFGAHGLKAHASPEQLAWWQTATDYFFYHALGLLALGILSKVLPHFPIKLSFLLIQIGILFFCGSLYIMALGLPRILGAITPIGGALMIAGWLILAWNAFKYAK 4WND Chain:B ((16-41)) ------------------QLLHSDHMEMEPETMET-KSVTDYFSK----------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4WND.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 3 387 128.83 14.87 target 2D structure prediction score : 0.19 Monomeric hydrophicity matching model chain B : 0.37 3D Compatibility (PKB) : 128.83 2D Compatibility (Sec. Struct. Predict.) : 0.19 1D Compatibility (Hydrophobicity) : 0.37 QMean score : 0.528

(partial model without unconserved sides chains): PDB file : Tito_4WND.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4WND-query.scw PDB file : Tito_Scwrl_4WND.pdb: