Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MLIYKVYLNIISLHWGRTDMNLSYLKTSLYTAATTAILLCSSQSQAQQYYKWMDKSGSTHYTTTPPPKGAKHLNKVSTYGSQPLLKNPTSNSEQPSQDKDKVVQEVTNVAVEKGAPAVPVPPAPSVSAPR 1TZI Chain:B ((73-130)) -----------------TSKNTAYLQM---RAEDTAVYYCSRSSYA--YY---DYWGQGTLVT---------VSSASTKGPSVFPLAPSSKS--------------------------------------

General information: TITO was launched using: RESULT: Template: 1TZI.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 66 -6920 -104.85 -119.31 target 2D structure prediction score : 0.31 Monomeric hydrophicity matching model chain B : 0.61 3D Compatibility (PKB) : -104.85 2D Compatibility (Sec. Struct. Predict.) : 0.31 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.200

(partial model without unconserved sides chains): PDB file : Tito_1TZI.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1TZI-query.scw PDB file : Tito_Scwrl_1TZI.pdb: