Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKLEQKIIDLLCEIPDNVDYTDVAEDLDLEDISEIRIKQLRELLTNSDIYTISSC 4YNL Chain:N ((256-269)) ------------------------------DVPPERWDEAMQEL-----------

General information: TITO was launched using: RESULT: Template: 4YNL.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain N - contact count / total energy / energy per contact / energy per residue : 6 -1582 -263.58 -112.96 target 2D structure prediction score : 0.36 Monomeric hydrophicity matching model chain N : 0.56 3D Compatibility (PKB) : -263.58 2D Compatibility (Sec. Struct. Predict.) : 0.36 1D Compatibility (Hydrophobicity) : 0.56 QMean score : 0.981

(partial model without unconserved sides chains): PDB file : Tito_4YNL.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4YNL-query.scw PDB file : Tito_Scwrl_4YNL.pdb: