Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKPDISELSVEELKRLQEEAEALIASKKDQAIEDAYNQIIEIAENVGFSVEQLLEFGAQKRKKTTRKSVEPRYRNKNNAEETWTGRGKQPRWLVAEIEKGAKLEDFLI 1YI8 Chain:B ((43-98)) --------SLQNRVRLQDEAELFVLLADVQALTDHFDRPEQVRENVLAVALDYLAAGLDPQKTT--------------------------------------------

General information: TITO was launched using: RESULT: Template: 1YI8.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 117 -3489 -29.82 -62.30 target 2D structure prediction score : 0.43 Monomeric hydrophicity matching model chain B : 0.68 3D Compatibility (PKB) : -29.82 2D Compatibility (Sec. Struct. Predict.) : 0.43 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.392

(partial model without unconserved sides chains): PDB file : Tito_1YI8.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1YI8-query.scw PDB file : Tito_Scwrl_1YI8.pdb: