Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSFWQKLFLADQQHNEHKNQTACVENDCSCKTNEQLLSALAQATDEDVIKGIKKVLISRGYSRKELNELTQKTSIH 4UG1 Chain:B ((22-40)) --------------------------------------------------EFKTGL--RGYSPEDVDEFLD-----

General information: TITO was launched using: RESULT: Template: 4UG1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 15 -1909 -127.23 -100.45 target 2D structure prediction score : 0.53 Monomeric hydrophicity matching model chain B : 0.67 3D Compatibility (PKB) : -127.23 2D Compatibility (Sec. Struct. Predict.) : 0.53 1D Compatibility (Hydrophobicity) : 0.67 QMean score : 0.809

(partial model without unconserved sides chains): PDB file : Tito_4UG1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4UG1-query.scw PDB file : Tito_Scwrl_4UG1.pdb: