Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MDLQGCLIVIKTDVIFDESNIIIGLFTIKDDHGIIQISTNGNQVNWDEWVDEAGGHSLEKAIIYCLNRKPPEDATHYKETKKQNSYRYYKKVEEDWFIYVDWRYPLGWQPTGMFDDITKIKPLPQFG 2Q76 Chain:B ((33-68)) ---------------------------------------------WIEWIKQRPGHSLE----WIGEILPGSDSTYYNEKVK---------------------------------------------

General information: TITO was launched using: RESULT: Template: 2Q76.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 70 3353 47.89 101.59 target 2D structure prediction score : 0.30 Monomeric hydrophicity matching model chain B : 0.54 3D Compatibility (PKB) : 47.89 2D Compatibility (Sec. Struct. Predict.) : 0.30 1D Compatibility (Hydrophobicity) : 0.54 QMean score : 0.280

(partial model without unconserved sides chains): PDB file : Tito_2Q76.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2Q76-query.scw PDB file : Tito_Scwrl_2Q76.pdb: