Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSLYITDECINCDVCEPVCPNEAIF--MGEVIYEINPDLCTECVGHHDQPQCQLFCPVDCIPKDPQH-EETEEQLLDKYKRLIAQKSTSN 1HFE Chain:L ((34-104)) -------KCIGCDTCSQYCPTAAIFGEMGEPHSIPHIEACINC------GQCLTHCPENAIYEAQSWVPEVEKKLKDGKVKCIA------

General information: TITO was launched using: RESULT: Template: 1HFE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain L - contact count / total energy / energy per contact / energy per residue : 180 -7960 -44.22 -117.05 target 2D structure prediction score : 0.56 Monomeric hydrophicity matching model chain L : 0.68 3D Compatibility (PKB) : -44.22 2D Compatibility (Sec. Struct. Predict.) : 0.56 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.396

(partial model without unconserved sides chains): PDB file : Tito_1HFE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1HFE-query.scw PDB file : Tito_Scwrl_1HFE.pdb: