Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MFFRIFTIFLLILSTNIEAKEKLITGEKIASSYKLLQSMTIPAIYENGMVLTKYANLYKMDNQCVIVSKLDNESNFGGYEDIIYFKNGIMLRSSKQSFFSIFLDDEAKIKSKEIKYGDFLNGKEVQKGLKEDFIQYRKKFNKYTLSKCS 4OO1 Chain:H ((166-228)) -----------------------------------------------------------------------------------FLKEGDLLNAEVQSLFQ---DGSASLHTRSLKYGKLRNG---------------------------

General information: TITO was launched using: RESULT: Template: 4OO1.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain H - contact count / total energy / energy per contact / energy per residue : 65 2780 42.77 77.22 target 2D structure prediction score : 0.64 Monomeric hydrophicity matching model chain H : 0.55 3D Compatibility (PKB) : 42.77 2D Compatibility (Sec. Struct. Predict.) : 0.64 1D Compatibility (Hydrophobicity) : 0.55 QMean score : 0.416

(partial model without unconserved sides chains): PDB file : Tito_4OO1.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4OO1-query.scw PDB file : Tito_Scwrl_4OO1.pdb: