Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPNNRILLVFSITIKGAVFLIKELFNLNKR--KDSIAKAIKLFLTRKTLIKQRNVLNLMTACLMGVLAII 4ZP3 Chain:M ((7-34)) --------------------DAELVRLSKRLVENAVLKAVQQYLEETQ----------------------

General information: TITO was launched using: RESULT: Template: 4ZP3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain M - contact count / total energy / energy per contact / energy per residue : 1 -34 -34.00 -1.31 target 2D structure prediction score : 0.73 Monomeric hydrophicity matching model chain M : 0.50 3D Compatibility (PKB) : -34.00 2D Compatibility (Sec. Struct. Predict.) : 0.73 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.592

(partial model without unconserved sides chains): PDB file : Tito_4ZP3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4ZP3-query.scw PDB file : Tito_Scwrl_4ZP3.pdb: