Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTEGRNQRKVYQGRVVSDKMDKTITVAVETKKNHPIYGKRMNYSKKYKVHDENNTAKVGDIVRIMETRPLSATKRFRLLEVVEEAVII 5NO3 Chain:Q ((3-80)) --------RTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGIGDVVEIRECRPLSKTKSWTLVRVVEKAV--

General information: TITO was launched using: RESULT: Template: 5NO3.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain Q - contact count / total energy / energy per contact / energy per residue : 300 -17805 -59.35 -228.27 target 2D structure prediction score : 0.46 Monomeric hydrophicity matching model chain Q : 0.85 3D Compatibility (PKB) : -59.35 2D Compatibility (Sec. Struct. Predict.) : 0.46 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.524

(partial model without unconserved sides chains): PDB file : Tito_5NO3.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5NO3-query.scw PDB file : Tito_Scwrl_5NO3.pdb: