Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTEHRSYYAIIPANVRYDKRLKPNTKLLYGEITALCNERGFCWAGNEYFADLYGVNKETISRWVSDLIKFGYLNREIIYKEGTNQIINRYLRINQYPIDEKRNTPIDEKVKDNNTSINNTFNNTKEYIRELPPSKKSKAKPVRHKYGEYKNVLLSDEQMEKLKTEFPNDY---QERIERLSEYCESSGKTYKNYLA--TIRS-WARKEKSEPKNASSGYKRTGRREKLPEWAIDQEAYLKKKALERANRQSKAPF 3S1D Chain:A ((446-485)) ----------------------------------------------------------------------------------------------------------------------------------------------------------------------PNDLARLQEQNRRILRFCDLAGIQYKTYLARHTDRSDWVR-------------------------------------------------

General information: TITO was launched using: RESULT: Template: 3S1D.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 15 -1620 -107.97 -47.63 target 2D structure prediction score : 0.44 Monomeric hydrophicity matching model chain A : 0.62 3D Compatibility (PKB) : -107.97 2D Compatibility (Sec. Struct. Predict.) : 0.44 1D Compatibility (Hydrophobicity) : 0.62 QMean score : 0.497

(partial model without unconserved sides chains): PDB file : Tito_3S1D.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3S1D-query.scw PDB file : Tito_Scwrl_3S1D.pdb: