Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWFHGKLSRREAEALLQL---NGDFLVRESTTTPGQYVLTGLQSGQPKHL-LLVDPEGVVRTKDHRFESVSHLISYH
3S8O Chain:A ((8-83))WFFGKIPRAKAEEMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYH


General information:
TITO was launched using:
RESULT:

Template: 3S8O.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 249 10781 43.30 149.73
target 2D structure prediction score : 0.76
Monomeric hydrophicity matching model chain A : 0.78

3D Compatibility (PKB) : 43.30
2D Compatibility (Sec. Struct. Predict.) : 0.76
1D Compatibility (Hydrophobicity) : 0.78
QMean score : 0.759

(partial model without unconserved sides chains):
PDB file : Tito_3S8O.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3S8O-query.scw
PDB file : Tito_Scwrl_3S8O.pdb: