Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceWFHGTLSRVKAAQLVLAGGPRNHGLFVIRQSETRPGEYVLTFNFQGKAKASHLRLSLNGHGQCHVQ------HLWFQSVLDMLRHF
2MK2 Chain:A ((13-94))WYHRDLSRAAAEELLARA--GRDGSFLVRDSESVAGAFALCVLYQKHVH--TYRILPDGEDFLAVQTSQGVPVRRFQTLGELIGLY


General information:
TITO was launched using:
RESULT:

Template: 2MK2.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 257 -38374 -149.31 -504.91
target 2D structure prediction score : 0.63
Monomeric hydrophicity matching model chain A : 0.74

3D Compatibility (PKB) : -149.31
2D Compatibility (Sec. Struct. Predict.) : 0.63
1D Compatibility (Hydrophobicity) : 0.74
QMean score : 0.592

(partial model without unconserved sides chains):
PDB file : Tito_2MK2.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-2MK2-query.scw
PDB file : Tito_Scwrl_2MK2.pdb: