Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WFFGAIRRSDAEKQLLYSENKTGSFLIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHY 3S8L Chain:A ((8-83)) WFFGKIPRAKAE-EMLSKQRHDGAFLIRESESAPGDFSLSVKFGNDVQHFKVLRDGAGKYFLWVVK-FNSLNELVDYH

General information: TITO was launched using: RESULT: Template: 3S8L.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 273 -43239 -158.38 -568.93 target 2D structure prediction score : 0.55 Monomeric hydrophicity matching model chain A : 0.78 3D Compatibility (PKB) : -158.38 2D Compatibility (Sec. Struct. Predict.) : 0.55 1D Compatibility (Hydrophobicity) : 0.78 QMean score : 0.715

(partial model without unconserved sides chains): PDB file : Tito_3S8L.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3S8L-query.scw PDB file : Tito_Scwrl_3S8L.pdb: