Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNMKLLIENMTCGGCARGVTATIQDVDPNAKVDVDLASKIVTVESSESVDKITEALEEDGFPAKVQ 1TL4 Chain:A ((9-59)) --------DMTCGGCAEAVSRVLNKLG-GVKYDIDLPNKKVCIESEHSMDTLLATLKKTG------

General information: TITO was launched using: RESULT: Template: 1TL4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 140 -22463 -160.45 -440.44 target 2D structure prediction score : 0.59 Monomeric hydrophicity matching model chain A : 0.77 3D Compatibility (PKB) : -160.45 2D Compatibility (Sec. Struct. Predict.) : 0.59 1D Compatibility (Hydrophobicity) : 0.77 QMean score : 0.608

(partial model without unconserved sides chains): PDB file : Tito_1TL4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1TL4-query.scw PDB file : Tito_Scwrl_1TL4.pdb: