Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MRCEMNIGQASKHSGISAKMIRYYEEIGLLEAAQRSASGYRIYSETDLKTLNFLKHARELGFSSEQMKELISLWKNTDRHSAEVKALTVKHIAELKQKIAHLQEMVNILQASADDCCGDQQASCAILDHIEKGVGVS 1JBG Chain:A ((5-79)) ------VKQVAEISGVSIRTLHHYDNIELLNPSALTDAGYRLYSDADLERLQQILFFKEIGFRLDEIKEMLD-HPNFDRKAA-------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 1JBG.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 206 -36320 -176.31 -484.27 target 2D structure prediction score : 0.67 Monomeric hydrophicity matching model chain A : 0.69 3D Compatibility (PKB) : -176.31 2D Compatibility (Sec. Struct. Predict.) : 0.67 1D Compatibility (Hydrophobicity) : 0.69 QMean score : 0.709

(partial model without unconserved sides chains): PDB file : Tito_1JBG.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1JBG-query.scw PDB file : Tito_Scwrl_1JBG.pdb: