Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MAKKGMINRELKREKTVAKYAVKRAELKATIANVNASDEERFEAMLKLQALPRNASPVRLRNRCGLTGRPHGYFRKFGLSRNKLRDTVMQGDVPGVVKASW 1HR0 Chain:N ((18-61)) ---------------------------------------------------------VRAYTRCVRCGRARSVYRFFGLCRICLRELAHKGQLPGVRKASW

General information: TITO was launched using: RESULT: Template: 1HR0.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain N - contact count / total energy / energy per contact / energy per residue : 117 -19605 -167.56 -445.56 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain N : 0.68 3D Compatibility (PKB) : -167.56 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.644

(partial model without unconserved sides chains): PDB file : Tito_1HR0.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1HR0-query.scw PDB file : Tito_Scwrl_1HR0.pdb: