Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNAKVNNKTMDWSKLSAHQWLEQYGLWVRSTKSKVSANPLACLIDQNDTTRIRSSKVSMPCEIEDYEAVEVSKLLAAMHNDEREFLQERAWLLILKYENDWSYRTIANTHGVGKDTVRKEIDKGLAYLDGKIEALAEFDNEKKSR 2LFW Chain:A ((82-148)) -----------------------------------------------------------------GTEAVARARLARMT-------PLSRQALLLTAMEGFSPEDAAYLIEVDTSEVETLVTEALAEIEKQTRALELVP------

General information: TITO was launched using: RESULT: Template: 2LFW.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 172 -17163 -99.78 -256.16 target 2D structure prediction score : 0.48 Monomeric hydrophicity matching model chain A : 0.60 3D Compatibility (PKB) : -99.78 2D Compatibility (Sec. Struct. Predict.) : 0.48 1D Compatibility (Hydrophobicity) : 0.60 QMean score : 0.323

(partial model without unconserved sides chains): PDB file : Tito_2LFW.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2LFW-query.scw PDB file : Tito_Scwrl_2LFW.pdb: