Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WYAGPMERAGAESILANRSDGTFLVRQRVKDAAEFAISIKYNVEVKHIKIMTA-EGLYRITEKKAFRGLTELVEFY 5DC4 Chain:A ((18-93)) WYHGPVSRNAAEYLLSSGINGSFLVRESESSPGQRSISLRYEGRVYHYRINTASDGKLYVSSESRFNTLAELVHHH

General information: TITO was launched using: RESULT: Template: 5DC4.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 264 -24144 -91.45 -321.91 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain A : 0.80 3D Compatibility (PKB) : -91.45 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.518

(partial model without unconserved sides chains): PDB file : Tito_5DC4.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5DC4-query.scw PDB file : Tito_Scwrl_5DC4.pdb: