Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence WLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRH---RQ---VKHYRIFRLPNNWYYISPRLTFQCLEDLVN 3VS5 Chain:A ((72-165)) WFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSYSLSVRDYDPRQGDTVKHYKIRT----GFYISPRSTFSTLQELVD

General information: TITO was launched using: RESULT: Template: 3VS5.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 233 -11452 -49.15 -161.29 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain A : 0.85 3D Compatibility (PKB) : -49.15 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.603

(partial model without unconserved sides chains): PDB file : Tito_3VS5.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3VS5-query.scw PDB file : Tito_Scwrl_3VS5.pdb: