Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTRTEYLTQLELYLKK--L-PEADRIEAMDYFRELFDDAGIEGEEELIASLG-TPKEAAHEVLSNLLDKKINEAPAQKNNRQILHIALLALLAAPIGIPLGIAILVTLFAILVAALTVILAFFAVSILGIIGGFLFLVESFTVLAQAKSAFILIFGSGLLAIGASSLVLLGISYVARFFGLLIVRLVQFVLKKGKRGNQHA 2O3L Chain:A ((18-79)) ---QFVFKKIQNYMWNFSAGNGMDMLHIQYELIDLFEAGAAEGR-QVLDITGEDVASFADELVANA---------------------------------------------------------------------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2O3L.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 134 -17326 -129.30 -298.72 target 2D structure prediction score : 0.69 Monomeric hydrophicity matching model chain A : 0.46 3D Compatibility (PKB) : -129.30 2D Compatibility (Sec. Struct. Predict.) : 0.69 1D Compatibility (Hydrophobicity) : 0.46 QMean score : 0.915

(partial model without unconserved sides chains): PDB file : Tito_2O3L.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2O3L-query.scw PDB file : Tito_Scwrl_2O3L.pdb: