Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MELVLPNNYVDLEQEEMMYLDGGGVGRNWWNSRGSFATVLDVGLAIYSGGATIYSAYAIKKAISANRGAITRTLRSLIIKHVGSAAGHLVNTALNVALTVTGFSLGGAIAYGADWADGSLDGYIFA 1VFA Chain:B ((17-36)) --------------------------------------------------------------------------------------------SLSITCTVSGFSLTG---YGVNW-----------

General information: TITO was launched using: RESULT: Template: 1VFA.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 11 -6300 -572.73 -315.00 target 2D structure prediction score : 0.95 Monomeric hydrophicity matching model chain B : 0.52 3D Compatibility (PKB) : -572.73 2D Compatibility (Sec. Struct. Predict.) : 0.95 1D Compatibility (Hydrophobicity) : 0.52 QMean score : 0.356

(partial model without unconserved sides chains): PDB file : Tito_1VFA.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1VFA-query.scw PDB file : Tito_Scwrl_1VFA.pdb: