Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKLKKEKKMAEFTFEIEEHLLTLSENEKGWTKEINRVSFNGAPAKFDIRAWSPDH---TKM-GKGITLSNEEFQTMVDAFKGN 1PCF Chain:E ((69-119)) ------------------------------MRYVSVRDFK-GKVLIDIREYWMDPEGEMKPGRKGISLNPEQWSQLKEQISD-

General information: TITO was launched using: RESULT: Template: 1PCF.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain E - contact count / total energy / energy per contact / energy per residue : 123 3520 28.61 74.88 target 2D structure prediction score : 0.66 Monomeric hydrophicity matching model chain E : 0.66 3D Compatibility (PKB) : 28.61 2D Compatibility (Sec. Struct. Predict.) : 0.66 1D Compatibility (Hydrophobicity) : 0.66 QMean score : 0.325

(partial model without unconserved sides chains): PDB file : Tito_1PCF.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1PCF-query.scw PDB file : Tito_Scwrl_1PCF.pdb: