Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MVETITIFVLAIFVGYYVVWGVTPALHTPLMAVTNALSSIIVVGAMLQTVGLPVLGVDANVAFQSVNVVSVLGAIAVFLASINIFGGFAVTARMLEMFKPKQKK 4KQ2 Chain:A ((520-557)) ---------LGVFPSYYEPWGYTPAECT-VMGVPSITTNVSGFGSYME--------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 4KQ2.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 139 -17279 -124.31 -454.70 target 2D structure prediction score : 0.18 Monomeric hydrophicity matching model chain A : 0.53 3D Compatibility (PKB) : -124.31 2D Compatibility (Sec. Struct. Predict.) : 0.18 1D Compatibility (Hydrophobicity) : 0.53 QMean score : 0.266

(partial model without unconserved sides chains): PDB file : Tito_4KQ2.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4KQ2-query.scw PDB file : Tito_Scwrl_4KQ2.pdb: